Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family TALE
Protein Properties Length: 467aa    MW: 50481.7 Da    PI: 7.0856
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                   HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                      Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                   +Fe+   +yp+ +e+e LA++ gL+ +qV++WF N R + 404 MFENflRPYPKDSEKEMLAARSGLSRSQVSNWFINARVR 442
                                   57766689*****************************88 PP

                          BELL   5 lqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                   +++ ++ Ll+ll+ +d+r +q+ +++q  +s +  ++  g  ++ + +   a+S  +r L+ +i+  i 272 HHRLRNDLLKLLQLMDQRCNQCLDEMQSAASKYGSMVRPGGGALSAPFSYTAVSAMHRRLRARIIAEI 339
                                   5666789*********************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF075262.4E-18208335IPR006563POX domain
PROSITE profilePS5007111.985383446IPR001356Homeobox domain
SMARTSM003898.9E-8386450IPR001356Homeobox domain
CDDcd000862.80E-12386447No hitNo description
PfamPF059207.3E-16403442IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5466441e-131AB546644.1 Triticum aestivum WBLH2-1 mRNA for BEL1-type homeodomain protein, complete cds.
GenBankAB5466451e-131AB546645.1 Triticum aestivum WBLH2-2 mRNA for BEL1-type homeodomain protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008658298.11e-180PREDICTED: putative POX domain/homeobox DNA-binding domain family protein isoform 1 isoform X1
RefseqXP_008658299.11e-180PREDICTED: putative POX domain/homeobox DNA-binding domain family protein isoform 1 isoform X1
RefseqXP_008658300.11e-180PREDICTED: putative POX domain/homeobox DNA-binding domain family protein isoform 1 isoform X1
RefseqXP_008658301.11e-180PREDICTED: putative POX domain/homeobox DNA-binding domain family protein isoform 1 isoform X1
RefseqXP_008658302.11e-180PREDICTED: putative POX domain/homeobox DNA-binding domain family protein isoform 1 isoform X1
TrEMBLC4IYV81e-180C4IYV8_MAIZE; Putative POX domain/homeobox DNA-binding domain family protein
STRINGGRMZM2G076272_P011e-180(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.13e-44homeobox gene 1